SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000017850 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000017850
Domain Number 1 Region: 327-608
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-86
Family Kelch motif 0.000000000024
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 5.76e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000017850   Gene: ENSPTRG00000010473   Transcript: ENSPTRT00000019286
Sequence length 624
Comment pep:known chromosome:CHIMP2.1.4:19:10681296:10699061:-1 gene:ENSPTRG00000010473 transcript:ENSPTRT00000019286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences A0A024R7C0 G3QHR9 H2QFB9 Q14145
ENSPTRP00000017850 ENSP00000171111 ENSP00000377245 ENSGGOP00000001903 HR6007 ENSP00000171111 NP_036421.2.87134 NP_036421.2.92137 NP_987096.1.87134 NP_987096.1.92137 XP_003809635.1.60992 XP_004060046.1.27298 XP_004060047.1.27298 XP_005260230.1.92137 XP_005260231.1.92137 XP_008960095.1.60992 XP_008960096.1.60992 XP_009432858.1.37143 XP_009432859.1.37143 XP_011526754.1.92137 XP_018871320.1.27298 XP_018871321.1.27298 ENSPTRP00000017850 ENSGGOP00000001903 ENSP00000171111 ENSP00000377245 gi|22027642|ref|NP_036421.2| gi|45269145|ref|NP_987096.1| 9598.ENSPTRP00000017850 9606.ENSP00000171111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]