SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000018969 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000018969
Domain Number 1 Region: 336-450,570-707
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.84e-67
Family Phosphate binding protein-like 0.000000106
Further Details:      
 
Domain Number 2 Region: 2-314
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.24e-33
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000018969   Gene: ENSPTRG00000011042   Transcript: ENSPTRT00000020521
Sequence length 902
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:47071260:47138019:-1 gene:ENSPTRG00000011042 transcript:ENSPTRT00000020521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHAVCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSL
YPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRGFLISKETLSVRMLDDSRD
PTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIV
EDSSNILGFSMFNTSHPFYPEFVRSLNMSWKENCEASTYLGPALSAALMFDAVHVVVSAV
RELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRIL
EKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALS
GNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKADLAVA
AFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVS
CVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTR
CVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFF
QNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQ
IGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKG
LGMENIGGIFVVLICGLIIAVFVAVMEFIWSTRRSAESEEVSVCQEMLQELRHAVSCRKT
SRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAHGGPQRLLDDPGPPSG
ARPTAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGAPAEATSPPRPRPGPAGPRELAE
HE
Download sequence
Identical sequences ENSPTRP00000018969 ENSPTRP00000018969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]