SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019254 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019254
Domain Number 1 Region: 75-131
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-17
Family Fibronectin type II module 0.0052
Further Details:      
 
Domain Number 2 Region: 44-87
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000457
Family Fibronectin type II module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019254   Gene: ENSPTRG00000011220   Transcript: ENSPTRT00000020849
Sequence length 132
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:52859494:52887570:-1 gene:ENSPTRG00000011220 transcript:ENSPTRT00000020849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVKDGECVFPFHYKNGTYYDCI
KSKARHKWCSLNKTYAGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTK
NFNKDQIWKYCE
Download sequence
Identical sequences H2QGQ3
ENSPTRP00000019254 ENSPTRP00000019254 9598.ENSPTRP00000019254 XP_009434222.1.37143 XP_016802362.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]