SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000019687 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000019687
Domain Number 1 Region: 44-137
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-27
Family I set domains 0.0000796
Further Details:      
 
Domain Number 2 Region: 139-238
Classification Level Classification E-value
Superfamily Immunoglobulin 4.95e-21
Family I set domains 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000019687   Gene: ENSPTRG00000011455   Transcript: ENSPTRT00000021329
Sequence length 299
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:59245024:59251058:-1 gene:ENSPTRG00000011455 transcript:ENSPTRT00000021329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWSHPSAQLQPVGGDAVSPALMALLCLGLSLGPRTHVQAGNLSKPTLWAEPGSVISRG
NPVTIRCQGTLEAQEYRLDKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYRS
PAGWSEPSDPLELVVTGFYNKPTLSTLPSPVVTSGENMTLQCGSWLRFNRFILTEEGDHK
LSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAA
DNLSPSQNKSDSGTASHLQDYTVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR
Download sequence
Identical sequences H2QH39
ENSPTRP00000019687 XP_003316722.1.37143 XP_016792302.1.37143 9598.ENSPTRP00000019687 ENSPTRP00000019687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]