SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020176 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020176
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Histone-fold 1.34e-38
Family Nucleosome core histones 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020176   Gene: ENSPTRG00000011740   Transcript: ENSPTRT00000021871
Sequence length 138
Comment pep:known chromosome:CHIMP2.1.4:2A:27162936:27170014:1 gene:ENSPTRG00000011740 transcript:ENSPTRT00000021871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRRRSRKPEAPRRRSPSPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLI
RKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLF
PKDVQLARRIRGLEEGLG
Download sequence
Identical sequences A0A2I3SW34
XP_003308962.1.37143 ENSPTRP00000020176 9598.ENSPTRP00000020176 ENSPTRP00000020176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]