SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020195 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020195
Domain Number 1 Region: 18-69,150-354
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.67e-23
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020195   Gene: ENSPTRG00000011751   Transcript: ENSPTRT00000021891
Sequence length 417
Comment pep:known chromosome:CHIMP2.1.4:2A:27507167:27511082:-1 gene:ENSPTRG00000011751 transcript:ENSPTRT00000021891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRAPELYRAPFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLERINGRLSAS
LLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKG
AAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDTTLLATGGTDGYVRV
WKVPSLEKVLEFKAHEGEIEDLALGPDGKLVTVGRDLKASVWQKDQLVTQLHWQENGPTF
SSTPYRYQACRFGQVPDQPAGLRLFTVQIPHKRLRQPPPCYLTAWDGSNFLPLRTKSCGH
EVVSCLDVSESGTFLGLGTVTGSVAIYIAFSLQCLYYVREAHGIVVTDVAFLPEKGRGPE
LLGSHETALFSVAVDSRCQLHLLPSRRSVPVWLLLLLCVGLIIVTILLLQSAFPGFL
Download sequence
Identical sequences H2QHL6
ENSPTRP00000020195 9598.ENSPTRP00000020195 XP_003827130.1.60992 XP_515352.3.37143 ENSPTRP00000020195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]