SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000020772 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000020772
Domain Number 1 Region: 38-111
Classification Level Classification E-value
Superfamily Histone-fold 9.43e-20
Family TBP-associated factors, TAFs 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000020772   Gene: ENSPTRG00000012105   Transcript: ENSPTRT00000022510
Sequence length 116
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2A:75929518:75940597:1 gene:ENSPTRG00000012105 transcript:ENSPTRT00000022510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAGSGTPREEEGPAGEAAVSQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQ
EAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
Download sequence
Identical sequences H2QI74
ENSPTRP00000020772 ENSPTRP00000020772 XP_003309117.1.37143 XP_003810367.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]