SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021050 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021050
Domain Number 1 Region: 248-351
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000877
Family Heme-binding PAS domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021050   Gene: ENSPTRG00000012287   Transcript: ENSPTRT00000022812
Sequence length 824
Comment pep:known chromosome:CHIMP2.1.4:2A:101095425:101285563:1 gene:ENSPTRG00000012287 transcript:ENSPTRT00000022812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPSEALHSSALKDKGSSLEPRQHFNALDVGASGLNTSHSPSASSRSSHKSSH
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAVLPPSLNLTTPASTSQDASQC
QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR
Download sequence
Identical sequences G3QU87 H2QIF6
ENSPTRP00000021050 ENSPTRP00000021050 9598.ENSPTRP00000021050 XP_003309213.1.37143 XP_004031560.2.27298 XP_008967036.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]