SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021480 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021480
Domain Number 1 Region: 350-487
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-33
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 2 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-33
Family C-type lectin domain 0.00061
Further Details:      
 
Domain Number 3 Region: 1370-1515
Classification Level Classification E-value
Superfamily C-type lectin-like 1.61e-28
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 4 Region: 949-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-27
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 5 Region: 1534-1662
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-27
Family C-type lectin domain 0.00074
Further Details:      
 
Domain Number 6 Region: 1107-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-26
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 7 Region: 634-792
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-25
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 8 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.18e-24
Family Cysteine rich domain 0.0093
Further Details:      
 
Domain Number 9 Region: 1661-1795
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-22
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 10 Region: 497-625
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-19
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 11 Region: 1239-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-18
Family C-type lectin domain 0.0055
Further Details:      
 
Domain Number 12 Region: 813-932
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-16
Family C-type lectin domain 0.014
Further Details:      
 
Domain Number 13 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000131
Family Fibronectin type II module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021480   Gene: ENSPTRG00000012566   Transcript: ENSPTRT00000023291
Sequence length 1873
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:164051025:164188528:-1 gene:ENSPTRG00000012566 transcript:ENSPTRT00000023291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGWATPRRPAGLLMLLFWFFDLAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVADDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAAR
YRLALKDGHGTAISNASDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIDGTWH
HDCILDEDHSGPWCATTLNYEYDRKWGICLKPENSCEDNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQRADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDVESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGEKLNDASSDKMCPPEEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDVDSRGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAM
STGKSIGKWEVKDCRSFKALSICKKMSGPLEPEEAAPKPDDPCPEGWQSFPASLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLMDQFSGQHWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIIPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFIYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEWPIDDHFTYSRYPWHRFPVTF
GEECLYMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQN
KCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
KINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSC
SERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVS
ITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKHLHFSRWAETNGQLEDCVVL
DTDGFWKTVDCNDNQPGAICYYSGDKTEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYGN
NSLMWFDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVIEETLYFHQHSILAC
KIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLF
LEDIVQRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCVLLDPKGTWKHE
KCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENAPRWIQYKGHCYKSDQALHSFSEAK
KLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVT
FVKWENKSKSGDGRCSMLIASNETWKKVECEHGFGRVLCKVPLDCPSSTWIQFQDSCYIF
LQEAIKVESLEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDD
ASFKWFDNSNMTFDKWTDQDNDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPY
KRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVL
VVGEENEYPVQFD
Download sequence
Identical sequences ENSPTRP00000021480 ENSPTRP00000021480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]