SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021507 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000021507
Domain Number - Region: 196-228
Classification Level Classification E-value
Superfamily Kringle-like 0.0593
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021507   Gene: ENSPTRG00000012589   Transcript: ENSPTRT00000023322
Sequence length 384
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:169198483:169256556:-1 gene:ENSPTRG00000012589 transcript:ENSPTRT00000023322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAKLGKVSLISTGLTTLILGIVMAR
AISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHM
SIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFV
TREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIP
SACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMAITNPQDCTHGQEMFYCFPDNFS
LTNTSESHVQQTTQLSTLNISIFQ
Download sequence
Identical sequences A0A2I2YRJ7 A0A2I3TSB2
ENSPTRP00000021507 9598.ENSPTRP00000021507 ENSPTRP00000021507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]