SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021687 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021687
Domain Number 1 Region: 29-148
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-33
Family FKBP immunophilin/proline isomerase 0.00023
Further Details:      
 
Domain Number 2 Region: 151-217
Classification Level Classification E-value
Superfamily EF-hand 0.000000000109
Family Calbindin D9K 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021687   Gene: ENSPTRG00000012689   Transcript: ENSPTRT00000023510
Sequence length 222
Comment pep:known chromosome:CHIMP2.1.4:2B:182955132:182970660:-1 gene:ENSPTRG00000012689 transcript:ENSPTRT00000023510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYG
KEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDTDNDRQLSKAEINLYLQREFEK
DEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Download sequence
Identical sequences A0A2I2Y4G4 H2QJ22
ENSPTRP00000021687 ENSPTRP00000021687 XP_003815559.2.60992 XP_004032917.2.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]