SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000021965 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000021965
Domain Number 1 Region: 243-660
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.33e-93
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00043
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.8e-37
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000021965   Gene: ENSPTRG00000012842   Transcript: ENSPTRT00000023825
Sequence length 727
Comment pep:known chromosome:CHIMP2.1.4:2B:210966683:211003086:-1 gene:ENSPTRG00000012842 transcript:ENSPTRT00000023825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVRKALVVLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTVMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQTFQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSA
LQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
Download sequence
Identical sequences H2QJA4
9598.ENSPTRP00000021965 ENSPTRP00000021965 ENSPTRP00000021965 XP_009442350.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]