SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000022106 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000022106
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.94e-82
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000816
Further Details:      
 
Domain Number 2 Region: 203-349
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.27e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000022106   Gene: ENSPTRG00000012938   Transcript: ENSPTRT00000023973
Sequence length 411
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:224132631:224138834:-1 gene:ENSPTRG00000012938 transcript:ENSPTRT00000023973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARLRPQLHFCLLLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFMELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSTTF
SDVLIFLDREPHRLRVFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVEDVVASCFAAVADHHLAQLA
FWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
Download sequence
Identical sequences 9598.ENSPTRP00000022106 ENSPTRP00000022106 ENSPTRP00000022106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]