SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023334 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023334
Domain Number 1 Region: 505-698
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-57
Family Hemopexin-like domain 0.00000000307
Further Details:      
 
Domain Number 2 Region: 114-213,387-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.14e-42
Family Matrix metalloproteases, catalytic domain 0.000000259
Further Details:      
 
Domain Number 3 Region: 335-390
Classification Level Classification E-value
Superfamily Kringle-like 2.74e-21
Family Fibronectin type II module 0.0000846
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-21
Family Fibronectin type II module 0.0000604
Further Details:      
 
Domain Number 5 Region: 219-273
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.0000665
Further Details:      
 
Domain Number 6 Region: 30-104
Classification Level Classification E-value
Superfamily PGBD-like 4.08e-18
Family MMP N-terminal domain 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023334   Gene: ENSPTRG00000013577   Transcript: ENSPTRT00000025282
Sequence length 699
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:43006799:43014400:1 gene:ENSPTRG00000013577 transcript:ENSPTRT00000025282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSER
PTAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGS
RPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGA
DVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYR
EKAYFCQDRFYWRVSSRNELNQVDQVGYVTYDILQCPED
Download sequence
Identical sequences H2QKI0
9598.ENSPTRP00000023334 ENSPTRP00000023334 ENSPTRP00000023334 XP_003317021.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]