SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025166 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025166
Domain Number 1 Region: 136-318
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.83e-47
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000182
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.46e-38
Family DNA repair glycosylase, N-terminal domain 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025166   Gene: ENSPTRG00000014593   Transcript: ENSPTRT00000027295
Sequence length 424
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:9961171:9976792:1 gene:ENSPTRG00000014593 transcript:ENSPTRT00000027295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAGLLGNAFDGHQLLRPLIFCQDHLREGPPIGRGDSQGEELEPQLP
SSLSSIPYGFCDHCWTKDVDDPPLVTHPSPGSRGGHMTQAWPVKVVSPLATVIGHVMQAR
LLAL
Download sequence
Identical sequences H2QM07
9598.ENSPTRP00000025166 ENSPTRP00000025166 ENSPTRP00000025166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]