SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025309 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025309
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily CSL zinc finger 4.71e-28
Family CSL zinc finger 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025309   Gene: ENSPTRG00000014671   Transcript: ENSPTRT00000027449
Sequence length 82
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:16499707:16504677:-1 gene:ENSPTRG00000014671 transcript:ENSPTRT00000027449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIVKVIYD
KDQFVCGETVPAPSANKELVKC
Download sequence
Identical sequences A0A2I3RTA6
XP_516312.2.37143 ENSPTRP00000025309 9598.ENSPTRP00000025309 ENSPTRP00000025309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]