SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025734 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025734
Domain Number 1 Region: 195-331,564-603,813-1027
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.81e-31
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 359-511,549-651,688-738,882-964
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.22e-18
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 
Domain Number 3 Region: 109-234
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000623
Family WD40-repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025734   Gene: ENSPTRG00000014905   Transcript: ENSPTRT00000027899
Sequence length 1072
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:49771569:49780530:1 gene:ENSPTRG00000014905 transcript:ENSPTRT00000027899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAARWEGSFSREFSSLLSRGCLRTSRIDMDALEAYLWPPAATTELLSPPTEPGCGGGR
LLHGFRVRPEPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFRELWRSGLWNMSDWIWDAR
WLEGNIALALGHNSLVLYDPVVGCILQEVPCTDRCTLSSACLIGYPWKELTIVAGAVSNQ
LLVWYPATALAHNKPVAPDRRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKVGDLRV
PGGRVQNIGHCFGHSARVWQVKLLENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGIRA
IAAHERQAWVITGGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLL
AVTDTGALYLYDVKVKCWEQLLEDKHFQSYCLLEAAPGPEGFGLCAMANGEGRVKVVPIN
TPTAAVDQTLFPGKVHSLSWALRGYEELLLLASGPGGVVACLEISAAPSGKAIFVKERCR
YLLPPSKQRWHTCSAFLPPGDFLVCGDRRGSVLLFPSRPGLLKDPGVGGKAGAGAGAPVV
GSGSSGGGNAFTGLGPVSTLPSLHGKQGVTSVTCHGGFVYTTGRDGAYYQLFVRDGQLQP
VLRQKSCRGMNWLAGLRIVPDGSMVILGFHANEFVVWNPRSHEKLHIVNCGGREITCVKR
VGTITLGPEYGVPSFMQPDDLEPGSEGPDLTDIVITCSEDTTVCVLALPTTTGSAHALTA
VCNHISSVRAVAVWGIGTPGGPQDPQPGLTAHVVSAGGRAEMHCFSIMVTPDPSTPSRLA
CHVMHLSSHRLDEYWDRQRNRHRMVKVDPETRYMSLAVCELDQPSLGPLVAAACSDGAVR
LFLLQDSGRILQLLAETFHHKRCVLKVHSFTHEAPNQRRRLLLCSAATDGSLAFWDLTTM
LDHESSVLEPPVDPGLPYRLGTPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHV
FVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPCAHAAHVTGLKILSPSIMVSASIDQRLT
FWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPEFGHRCALGGQGLEVYNWYD
Download sequence
Identical sequences ENSPTRP00000025734 ENSPTRP00000025734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]