SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026959 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000026959
Domain Number - Region: 1352-1408
Classification Level Classification E-value
Superfamily Histone-fold 0.0394
Family TBP-associated factors, TAFs 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026959   Gene: ENSPTRG00000015670   Transcript: ENSPTRT00000029213
Sequence length 1416
Comment pep:known chromosome:CHIMP2.1.4:3:187743702:187837575:1 gene:ENSPTRG00000015670 transcript:ENSPTRT00000029213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGIKRTIKETDPDYEDVSVALPNKRHKAIENSARDAAVQKIETIIKEQFALEMKNKEHE
IEVIDQRLIEARRMMDKLRACIVANYYASAGLLKVSEGSKTCDTMVFNHPAIKKFLESPS
RSSSPANQRAETPSANHSESDSLSQHNDFLSDKDNNSNMDIEERLSNNMEQKPSRNTGRD
TSSVTGSHKTEQRNADLTDETSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRG
SRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKR
IDIIHNLKLDRTYTGLQTLGAETVVDVELHRHSLGEDCIYPQSSESDISDAPPSLPLTIP
APVKASSPIKQSHEPVPDTSVEKGFPASTEAERHTPFYALPSSLERTPTKMTTAQKVTFC
SHGNSAFQPIASSCKIVPQSQVPNPESPGKSFQPITMSCKIVSGSPISTPSPSPLPRTPT
STPVHVKQGTAGSVINNPYVIMDKQPGQVIGATTPSTGSPTNKISTASQVSQGTGSPVPK
IHGSSFVTSTVKQEDSLFASMPPLCPIGSHPKVQSPKPITGGLGAFTKVIIKQEPGEAPH
VPATGAASQSPLPQYVTVKGGHMIAVSPQKQVITTGEGIAQSAKVQPSKVVGVPVGSALP
STVKQAVAISGGQILVAKASSSVSKAVGPKQVVTQGVAKAIVSGGGGTIVAQPVQTLTKA
QVTAAGPQKSGSQGSVMATLQLPATNLANLANLPPGTKLYLTTNSKNPSGKGKLLLIPQG
AILRATNNANLQSGSAASGGSGAGGGGGGGSGSGGGGSTGGGTAGGGTQSTAGPGGISQH
LTYTSYILKQTPQGTFLVGQPSPQTSGKQLTTGSVVQGTLGVSTSSAQGQQTLKVISGQK
TTLFTQAAHGGQASLMKISDSTLKTVPATSQLSKPGTTMLRVAGGVITTATSPAVALSAN
GPAQQSEGMAPMSSSMVSSVTKTSGQQQVCVSQATVGTCKAATPTVVSATSLVPTPNPIS
GKATVSGLLKIHSSQSNPQQAVLTIPSQLKPLSVNTSGGVQTILMPVNKVVQSFSTSKPP
AILPVAAPTPVVPSSAPAAVAKVKTEPETPGPSCLSQEGQTAVKTEESSELGNYVIKIDH
LETIQQLLTAVVKKIPLITAKSEDASCFSAKSVEQYYGWNIGKRRAAEWQRAMTMRKVLQ
EILEKNPRFHHLTPLKTKHIAHWCRCHGYTPPDPESLRNDGDSIEDVLTQIDSEPECPSS
FSSADNLCRKLEDLQQFQKREPENEEEVDILSLSEPVKINIKKEQEEKQEEVKFYLPPTP
GSEFIGDVTQKIGITLQPVALHRNVYASVVEDMILKATEQLVNDILRQALAVGYQTASHN
RIPKEITVSNIHQAICNIPFLDFLTNKHMGILNEDQ
Download sequence
Identical sequences K7DTE5
ENSPTRP00000026959 ENSPTRP00000026959 9598.ENSPTRP00000026959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]