SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027087 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000027087
Domain Number - Region: 13-44
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0834
Family NlpC/P60 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027087   Gene: ENSPTRG00000015748   Transcript: ENSPTRT00000029345
Sequence length 168
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:197324687:197355792:1 gene:ENSPTRG00000015748 transcript:ENSPTRT00000029345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVF
SSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCE
HFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY
Download sequence
Identical sequences G3RK40 Q9HDD0
ENSP00000473258 9598.ENSPTRP00000027087 9606.ENSP00000264735 ENSPTRP00000027087 gi|9966859|ref|NP_065119.1| ENSGGOP00000016097 ENSP00000264735 ENSGGOP00000016097 HR79 XP_016862412.1.92137 XP_018878408.1.27298 ENSPTRP00000027087 ENSNLEP00000008253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]