SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027169 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027169
Domain Number 1 Region: 300-638
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-112
Family Transferrin 0.000000491
Further Details:      
 
Domain Number 2 Region: 2-289
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.03e-97
Family Transferrin 0.000000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027169   Gene: ENSPTRG00000015792   Transcript: ENSPTRT00000029441
Sequence length 651
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:201037341:201061117:-1 gene:ENSPTRG00000015792 transcript:ENSPTRT00000029441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVRRSSHVTIDTLKG
VKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETHYSESLC
RLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKTLPSWGQ
ALLSQDFELLCRDGRRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQRLFSHE
GSSFQMFSSEAYGQKDLLFKDSTSELVPITTQTYEAWLGHEYLHAMKGLLCDPNRLPLYL
RWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQHCMERIQAEQVDAVTLSGEDIY
TAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDELRGKRSCHAGFGSPAGW
DVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEQGRNKCV
GNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYELLCPNG
ARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNY
HGQDLLFKDATVRAVPVGEKTSYRDWLGLDYVAALEGMLSQQCSGAGRTGP
Download sequence
Identical sequences ENSPTRP00000027169 ENSPTRP00000027169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]