SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000027328 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000027328
Domain Number 1 Region: 390-653
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-75
Family Eukaryotic proteases 0.0000969
Further Details:      
 
Domain Number 2 Region: 265-371
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-32
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 3 Region: 101-150
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-17
Family Fibronectin type II module 0.0019
Further Details:      
 
Domain Number 4 Region: 161-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000197
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000027328   Gene: ENSPTRG00000015857   Transcript: ENSPTRT00000029616
Sequence length 662
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:3520338:3527954:1 gene:ENSPTRG00000015857 transcript:ENSPTRT00000029616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWAWVPSPCPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATVTPAIPTILV
TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGGRWARVLQGHVEQCECLGGRTWCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFTGRLCNIEPDERCFLGNGTGYRGVAST
SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
YCRLEACDLETEGREYLTRVQLSADLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSS
SLPGSHPWLAAIYIGDGFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDV
TQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGH
KCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDA
CQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVA
PS
Download sequence
Identical sequences A0A2I3S7S3
ENSPTRP00000027328 ENSPTRP00000027328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]