SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028020 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028020
Domain Number 1 Region: 16-116
Classification Level Classification E-value
Superfamily Histone-fold 5.42e-64
Family Nucleosome core histones 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028020   Gene: ENSPTRG00000016312   Transcript: ENSPTRT00000030354
Sequence length 128
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:102429442:102431631:-1 gene:ENSPTRG00000016312 transcript:ENSPTRT00000030354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
Download sequence
Identical sequences A0A0D9S9R8 A0A0P6CLJ9 A0A0P6JTJ4 A0A1U7TGL0 A0A250Y9S9 A0A2I2YTF8 A0A2I3HH82 A0A2I3MHN9 A0A2J8TQK0 A0A2K5CPY6 A0A2K5PVY8 A0A2K5ZJJ1 A0A2K6CU10 A0A2K6K572 A0A2K6QU79 B1PEY3 F7I4U5 G7P5Z7 H0WMR3 H2QPY3 H9EM58 I3N2S4 K4G858 P0C0S4 P0C0S5 P0C0S6 P0C0S7 P22647 Q5RC42 Q6YNC8
ENSNLEP00000016551 ENSRNOP00000013919 ENSCJAP00000028084 ENSCJAP00000040467 ENSDNOP00000026593 ENSCJAP00000028084 ENSCJAP00000040467 ENSP00000296417 NP_001009270.1.54773 NP_001009270.1.66739 NP_001116594.1.46622 NP_001127318.1.23681 NP_001180479.1.72884 NP_001274021.1.84170 NP_002097.1.87134 NP_002097.1.92137 NP_058030.1.92730 NP_073165.1.100692 NP_073165.1.4139 NP_777234.1.59421 NP_777234.1.76553 XP_002743705.1.60252 XP_002928044.1.58354 XP_003257543.1.23891 XP_003798557.1.62490 XP_003829988.1.60992 XP_004040232.1.27298 XP_004263611.1.21590 XP_004380242.1.4749 XP_004391529.1.74151 XP_004431055.1.5094 XP_004462010.1.11602 XP_004661700.1.11716 XP_004866335.1.39548 XP_005325808.1.77405 XP_005406318.1.28644 XP_005555595.1.63531 XP_005910369.1.15283 XP_006152220.1.99106 XP_006208989.1.17985 XP_006773066.1.95426 XP_006876436.1.41390 XP_006918930.1.64745 XP_006918931.1.64745 XP_007172968.1.59432 XP_007463865.1.90284 XP_007605775.1.69978 XP_007628993.1.28591 XP_007947050.1.48129 XP_007997575.1.81039 XP_007997839.1.81039 XP_008052112.1.4292 XP_008154876.1.99482 XP_008532962.1.77740 XP_008583237.1.73410 XP_008824387.1.79516 XP_008991175.1.60252 XP_010366876.1.97406 XP_010369946.1.97406 XP_010372444.1.97406 XP_010804249.1.76553 XP_010848781.1.44457 XP_010951878.1.22495 XP_010978927.1.51371 XP_011747515.1.29376 XP_011824753.1.47321 XP_012593851.1.48125 XP_012909507.1.14098 XP_016014607.1.101085 XP_016079074.1.3490 XP_017366847.1.71028 XP_017506900.1.32401 XP_017707858.1.44346 XP_017904762.1.57651 XP_019271334.1.44245 XP_019517228.1.44202 XP_019613239.1.88060 XP_019782029.1.83887 XP_019817953.1.53367 XP_020036586.1.5219 XP_020389523.1.65276 XP_020739885.1.74333 XP_020843946.1.61212 XP_021051171.1.100879 XP_021512964.1.76796 XP_021532053.1.9421 XP_021536052.1.83697 XP_517363.3.37143 1f66C gi|4504255|ref|NP_002097.1| 10090.ENSMUSP00000036907 10116.ENSRNOP00000013919 9598.ENSPTRP00000028020 9606.ENSP00000296417 9615.ENSCAFP00000015623 ENSMUSP00000036907 ENSGGOP00000026163 ENSP00000296417 ENSOGAP00000003049 ENSP00000296417 ENSPTRP00000028020 ENSPPYP00000016702 ENSOGAP00000003049 ENSGGOP00000026163 ENSMUSP00000036907 ENSPTRP00000028020 ENSPPYP00000016702 1f66_C 1f66_G ENSNLEP00000016551 ENSMUSP00000036907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]