SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028067 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028067
Domain Number 1 Region: 35-332
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-108
Family Inorganic pyrophosphatase 0.0000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028067   Gene: ENSPTRG00000016335   Transcript: ENSPTRT00000030401
Sequence length 334
Comment pep:known chromosome:CHIMP2.1.4:4:107944176:108049732:-1 gene:ENSPTRG00000016335 transcript:ENSPTRT00000030401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQY
VKDGKLRYVANIFPYKGYIWNYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSC
GEVIHVKILGILALIDEGETDWKLIAINANDPEASKFHDIDDVKKFKPGYLEATLNWFRL
YKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLMKKCNGGAINCTNVQISDSPF
RCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK
Download sequence
Identical sequences H2QPZ6 Q9H2U2
ENSPTRP00000028067 NP_789845.1.87134 NP_789845.1.92137 XP_003830017.1.60992 XP_517378.2.37143 9606.ENSP00000343885 ENSP00000343885 ENSPTRP00000028067 gi|29171702|ref|NP_789845.1| ENSP00000343885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]