SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028150 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028150
Domain Number 1 Region: 614-874
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.28e-80
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 498-599
Classification Level Classification E-value
Superfamily SRCR-like 7.85e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000749
Further Details:      
 
Domain Number 3 Region: 280-382
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 4 Region: 387-487
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 167-270
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 99-171
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-16
Family Kringle modules 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028150   Gene: ENSPTRG00000016390   Transcript: ENSPTRT00000030484
Sequence length 875
Comment pep:known chromosome:CHIMP2.1.4:4:120948261:121021496:-1 gene:ENSPTRG00000016390 transcript:ENSPTRT00000030484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFVLALMLGALPEVVGFDSVLNDSLHHSHRHSPPPGPHYPYYLPTQQRPPRTRPPP
PLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGAPCLRWAEVPPFLE
RSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEFE
GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCR
GDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLAGGSSVHEGRVELYHAGQ
WGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCP
KSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELN
TYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHRED
VSIACYPGGEGHRLSLGFPVRLVDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQ
LGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICD
YFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLL
CGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRP
DRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRT
LQQAAIPLLPKRFCEERYKRRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVV
YGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences K7AYK8 Q5G271
ENSPTRP00000028150 9598.ENSPTRP00000028150 NP_001065275.1.37143 ENSPTRP00000028150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]