SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028501 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028501
Domain Number 1 Region: 391-683
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.76e-56
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 61-310
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.21e-33
Family WD40-repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028501   Gene: ENSPTRG00000016611   Transcript: ENSPTRT00000030861
Sequence length 1322
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:179275657:179392858:1 gene:ENSPTRG00000016611 transcript:ENSPTRT00000030861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWMTYISNWFEQDDWYEGLQRANMSQVRQVGLLAAGCQPWNKDVCAASGDRFAYCATLA
IYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDLFASGSTDNLVIIWNVAEQKVIA
KLDSTKGIPASLSWCWNAEDVVAFVSHRGPLFIWTISGPDSGVIVHKDAHSFLSDICMFR
WHTHQKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTDEEDPVTALEWDPLSTDYLL
VVNLHYGIRLVDSESLSCITTFNLPSAAASVQCLAWVPSAPGMFITGDSQVGVLRIWNVS
RTTPIDNLKLKKTGFHCLHVLNSPPRKKFSVQSPTKNHYTSSTSEAVPPPTLTQNQAFSL
PPGHAVCCFLDGGVGLYDMGAKKWDFLRDLGHVETIFDCKFKPDDPNLLATASFDGTIKV
WDINTLTAVYTSPGNEGVIYSLSWAPGGLNCIAGGTSRNGAFIWNVQKGKIIQRFNEHGT
NGIFCVAWSHKDSKRIATCSSDGFCIIRTIDGKVLHKYKHPAAVFGCDWSQNNKDMIATG
CEDTNVRVYYVATSSDQPLKVFSGHTAKVFHVKWSPLREGILCSGSDDGTVRIWDYTQDA
CINILNGHTAPVRGLMWNTEIPYLLISGSWDYTIKVWDTREGTCVDTVYDHGADVYGLTC
HSSRPFTMASCSRDSTVRLWSLTALVTPVQINILADRSWEEIIGNTDYAIEPGTPPLLCG
KVSRDIRQEIEKLTANSQVKKLRWFSECFSPPGGSDNLWNLVAVIKGQDDSLLPQNYCKG
IMHLKHLIKFRTSEAQELTTVKMSKFGGGIGVPTKEERLKEAAEIHLRLGQIQRYCELMV
ELGEWDKALSIAPGVSVKYWKKLMQRRADQLIQEDKDDVIPYCIAIGDVKKLVHFFMSRG
QLKEALLVAQAACEGNMQPLHVSVPKGASYSDDIYKEDYNELLHKVSKELAEWYFQDGRA
VLAACCHLAIDNIELAMAYLIRGNELELAVCVGTVLGESAAPATHYALELLARKCMMISV
CFPCVGYSVPFCYINRNLAADLLLMIPDNELHLIKLCAFYPGCTEEINDLHDKCKLPTVE
ECMQLAETAHADDNIFETVKYYLLSQEPEKALPIGISFVKEYISSSDWTLDTIYPVLDLL
SYIRTEKLLLHTCTEARNELLILCGYIGALLAIRRQYQSIVPALYEYTSQLLKRREVSVP
LKIEYLSEELDAWRACTQSTNRSLEDSPYTPPSDSQRMIYATLLKRLKEESLKGIIGPDY
VTGSNLPSHSDIHISCLTGLKIQGPVFFLEDGKSAISLNDALMWAKVNPFSPLGTGIRLN
PF
Download sequence
Identical sequences A0A2J8MR21
ENSPTRP00000028501 9598.ENSPTRP00000028501 ENSPTRP00000028501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]