SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028509 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028509
Domain Number 1 Region: 155-250
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.57e-21
Family Middle domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number 2 Region: 62-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000406
Family N-terminal domain of MutM-like DNA repair proteins 0.01
Further Details:      
 
Domain Number 3 Region: 318-345
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00001
Family Ran binding protein zinc finger-like 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000028509
Domain Number - Region: 246-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0371
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028509   Gene: ENSPTRG00000016617   Transcript: ENSPTRT00000030869
Sequence length 606
Comment pep:known chromosome:CHIMP2.1.4:4:180556169:180609829:1 gene:ENSPTRG00000016617 transcript:ENSPTRT00000030869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVLPGQAVTSVRGSALRSLQGRALRLAASTAVVSPQAAALNNND
SSQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVL
EVQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSSEFSFLRAESEVKKQKGRMLGD
VLMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAG
LALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQKENPQHVDICKLPTRNTII
SWTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACDACLTSRPIDSVLKSEENSTVF
SHLMKYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNS
TPTNVCLNDIQHPSKKTTNDITQLSSKVNISPTISSESKLFSPAHKKLKTAHYSSAELKS
CNPGYSNSELQINITDGPHTLNPDSPRCSKHNRLCILRVVRKDGENKGRQFYACPLPREA
QCGFFEWADLSFPFCNHGKRSIMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGI
KIIPGC
Download sequence
Identical sequences A0A2I3SBM0
9598.ENSPTRP00000028509 ENSPTRP00000028509 ENSPTRP00000028509 XP_526741.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]