SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000028888 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000028888
Domain Number 1 Region: 46-184
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 9.29e-47
Family Molybdopterin synthase subunit MoaE 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000028888   Gene: ENSPTRG00000016862   Transcript: ENSPTRT00000031279
Sequence length 188
Comment pep:known chromosome:CHIMP2.1.4:5:62410316:62422778:1 gene:ENSPTRG00000016862 transcript:ENSPTRT00000031279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSCFNLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVS
QLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNK
ECFWASNS
Download sequence
Identical sequences H2QQV7
ENSPTRP00000028888 9598.ENSPTRP00000028888 XP_001149868.1.37143 XP_001149943.3.37143 ENSPTRP00000028888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]