SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029517 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029517
Domain Number 1 Region: 181-368
Classification Level Classification E-value
Superfamily Macro domain-like 5.72e-52
Family Macro domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 12-117
Classification Level Classification E-value
Superfamily Histone-fold 9.83e-39
Family Nucleosome core histones 0.00000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029517   Gene: ENSPTRG00000017256   Transcript: ENSPTRT00000031944
Sequence length 372
Comment pep:known chromosome:CHIMP2.1.4:5:136026184:136092833:-1 gene:ENSPTRG00000017256 transcript:ENSPTRT00000031944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
KGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPA
DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKE
FVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL
ADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIG
IYVQEMAKLDAN
Download sequence
Identical sequences A0A091CNU6 A0A2J8VQ67 A0A2K5HRC8 A0A2K5ZHE4 A0A2K6BUT6 A0A2K6EU20 A0A2K6LBL0 A0A2K6RXM8 A0A2K6UYW1 D2GVK3 E2RCZ7 F7I8A7 G3QH59 G5BQ26 G7P8B7 H2QRI8 I2CUE9 M3YF29 O75367
ENSP00000302572 ENSPTRP00000029517 ENSTTRP00000005783 ENSP00000423563 ENSP00000424971 ENSPANP00000005730 NP_001229351.1.37143 NP_613258.2.87134 NP_613258.2.92137 XP_002744219.1.60252 XP_002912970.1.58354 XP_003829310.1.60992 XP_004042582.1.27298 XP_004282152.1.21590 XP_004405523.1.74151 XP_004405524.1.74151 XP_004632307.1.9945 XP_004744987.1.14098 XP_004836268.1.39548 XP_004836269.1.39548 XP_005376528.1.28644 XP_005557873.1.63531 XP_006166901.1.99106 XP_006927673.1.62641 XP_007077891.1.5354 XP_007101451.1.24612 XP_007461438.1.90284 XP_007461439.1.90284 XP_008012684.1.81039 XP_008689810.1.72690 XP_010336904.1.74449 XP_010358217.1.97406 XP_010612386.1.5607 XP_011542031.1.92137 XP_011714837.1.29376 XP_011790631.1.43180 XP_011790632.1.43180 XP_011790634.1.43180 XP_011824586.1.47321 XP_011824587.1.47321 XP_011945703.1.92194 XP_012292871.1.9421 XP_012292944.1.9421 XP_012506787.1.63892 XP_012617662.1.48125 XP_014943102.1.86478 XP_014996351.1.72884 XP_014996352.1.72884 XP_017387825.1.71028 XP_017387826.1.71028 XP_017387827.1.71028 XP_017387828.1.71028 XP_017727420.1.44346 XP_017823219.1.60252 XP_019277489.1.44245 XP_021557716.1.83697 XP_538635.3.84170 9544.ENSMMUP00000008438 9598.ENSPTRP00000029517 9606.ENSP00000353806 9685.ENSFCAP00000012912 ENSCJAP00000010796 ENSMPUP00000009936 ENSMMUP00000008438 ENSFCAP00000012912 gi|93141018|ref|NP_613258.2| ENSP00000423563 ENSP00000424971 ENSAMEP00000018897 ENSCAFP00000001514 ENSFCAP00000012912 400374 ENSTTRP00000005783 HGL_H00000353806 ENSMMUP00000008438 ENSPTRP00000029517 ENSCAFP00000001514 ENSMPUP00000009936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]