SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000029795 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000029795
Domain Number 1 Region: 407-521,641-787
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-63
Family Phosphate binding protein-like 0.00000000208
Further Details:      
 
Domain Number 2 Region: 20-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.76e-56
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 3 Region: 537-640
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000235
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000029795   Gene: ENSPTRG00000017441   Transcript: ENSPTRT00000032251
Sequence length 906
Comment pep:known chromosome:CHIMP2.1.4:5:154321508:154651692:1 gene:ENSPTRG00000017441 transcript:ENSPTRT00000032251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
Download sequence
Identical sequences A0A2I3S455 A0A2K5ZIC8 G7MVP5 G7P8R7 P42261
ENSMMUP00000012165 ENSP00000285900 ENSPTRP00000029795 ENSPTRP00000029795 9544.ENSMMUP00000012165 9598.ENSPTRP00000029795 9606.ENSP00000285900 NP_000818.2.87134 NP_000818.2.92137 NP_001252714.1.72884 XP_003310973.1.37143 XP_003829024.1.60992 XP_005558390.1.63531 XP_008013263.1.81039 XP_011787026.1.43180 XP_011836620.1.47321 XP_011924251.1.92194 ENSP00000285900 ENSMMUP00000012165 gi|167001419|ref|NP_000818.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]