SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030035 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030035
Domain Number 1 Region: 357-613
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-79
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 196-305
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-32
Family Kringle modules 0.00036
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 5.37e-20
Family Fibronectin type II module 0.0039
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000439
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000030035
Domain Number - Region: 132-167
Classification Level Classification E-value
Superfamily FnI-like domain 0.0523
Family Fibronectin type I module 0.0084
Further Details:      
 
Domain Number - Region: 177-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030035   Gene: ENSPTRG00000017583   Transcript: ENSPTRT00000032505
Sequence length 615
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:178478649:178486094:-1 gene:ENSPTRG00000017583 transcript:ENSPTRT00000032505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGFLLVSLESTLSIPPWKAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGRFCDVDTKASCYDGRGLSYRGLARTTLSGAPCEP
WASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQ
AAPPTPVSPRLHVPLMPAQPAPLKPQPATRTPPQSQTPGALPAKREQPPSLTRNGPLSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERHNHSCEQCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGS
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTVS
Download sequence
Identical sequences H2QS39
XP_518130.2.37143 9598.ENSPTRP00000030035 ENSPTRP00000030035 ENSPTRP00000030035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]