SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030101 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030101
Domain Number 1 Region: 60-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-88
Family Calnexin/calreticulin 0.00000000256
Further Details:      
 
Domain Number 2 Region: 269-409
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.54e-59
Family P-domain of calnexin/calreticulin 0.0000000326
Further Details:      
 
Domain Number 3 Region: 412-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000222
Family Calnexin/calreticulin 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030101   Gene: ENSPTRG00000017621   Transcript: ENSPTRT00000032576
Sequence length 592
Comment pep:known chromosome:CHIMP2.1.4:5:180836937:180870684:1 gene:ENSPTRG00000017621 transcript:ENSPTRT00000032576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKC
ESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSAMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences A0A2J8SCW5 H2QS56 Q5R440
ENSPTRP00000030101 XP_001151242.1.37143 XP_016809920.1.37143 XP_518152.2.37143 ENSPTRP00000030101 9598.ENSPTRP00000030101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]