SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030373 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030373
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 5.24e-48
Family Nucleosome core histones 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030373   Gene: ENSPTRG00000017789   Transcript: ENSPTRT00000032873
Sequence length 131
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:25986969:25987364:-1 gene:ENSPTRG00000017789 transcript:ENSPTRT00000032873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLT
AEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHHHKAQSK
Download sequence
Identical sequences H2QSE5 Q96QV6
ENSP00000297012 ENSPTRP00000030373 9598.ENSPTRP00000030373 9606.ENSP00000297012 ENSP00000297012 ENSP00000297012 gi|25092737|ref|NP_734466.1| ENSPTRP00000030373 NP_734466.1.87134 NP_734466.1.92137 XP_003823260.1.60992 XP_518282.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]