SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030374 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030374
Domain Number 1 Region: 12-127
Classification Level Classification E-value
Superfamily Histone-fold 8.52e-57
Family Nucleosome core histones 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030374   Gene: ENSPTRG00000017790   Transcript: ENSPTRT00000032874
Sequence length 127
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:25987746:25988176:1 gene:ENSPTRG00000017790 transcript:ENSPTRT00000032874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
Download sequence
Identical sequences A0A0B4J2I5 Q96A08
ENSP00000274764 ENSP00000274764 9598.ENSPTRP00000030374 9606.ENSP00000274764 gi|24586679|ref|NP_733759.1| ENSPTRP00000030374 ENSPTRP00000030374 ENSP00000274764 NP_733759.1.87134 NP_733759.1.92137 XP_003823261.1.60992 XP_527247.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]