SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030389 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030389
Domain Number 1 Region: 14-115
Classification Level Classification E-value
Superfamily Histone-fold 3.58e-75
Family Nucleosome core histones 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030389   Gene: ENSPTRG00000017801   Transcript: ENSPTRT00000032889
Sequence length 130
Comment pep:novel chromosome:CHIMP2.1.4:6:26297225:26297617:-1 gene:ENSPTRG00000017801 transcript:ENSPTRT00000032889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
Download sequence
Identical sequences A0A096NQ36 A0A0D9SCL9 A0A1S3AG75 A0A1S3GP55 A0A1U7T6X1 A0A212D524 A0A250XV11 A0A2J8S4W0 A0A2K5BVX5 A0A2K5HEX4 A0A2K5KPC2 A0A2K5PF96 A0A2K5UN85 A0A2K5XFJ5 A0A2K6AT72 A0A2K6GP19 A0A2K6JZW3 A0A2K6NMG4 A0A2K6SFI6 B2RVF0 C0HKE1 C0HKE2 C0HKE3 C0HKE4 C0HKE5 C0HKE6 C0HKE7 C0HKE8 C0HKE9 F2Z587 F7CMF9 F7HAT6 G1S9R8 G1TMN0 G3HDU4 G3RKB0 G3SYD8 G3V9C0 G8JL00 H0XV68 H2QSF5 I3MZM1 J9JHP2 L8IQP7 M3X700 P04908 Q08AJ9 S9X3T8
ENSFCAP00000007654 gi|10645195|ref|NP_066390.1| gi|19557656|ref|NP_003504.2| ENSCAFP00000035973 NP_001100824.1.100692 NP_001100824.1.4139 NP_001171015.1.92730 NP_001180653.1.72884 NP_003504.2.87134 NP_003504.2.92137 NP_066390.1.87134 NP_066390.1.92137 NP_783591.2.92730 NP_835489.1.92730 NP_835491.1.92730 NP_835492.1.92730 NP_835493.1.92730 NP_835494.1.92730 NP_835495.1.92730 NP_835496.1.92730 XP_001061350.3.4139 XP_001062714.1.4139 XP_001087578.1.72884 XP_001172704.1.37143 XP_002714248.1.1745 XP_002728525.1.100692 XP_002746181.1.60252 XP_002816551.1.23681 XP_003263319.1.23891 XP_003416456.1.64505 XP_003502207.1.69978 XP_003502217.1.69978 XP_003512228.1.69978 XP_003640210.1.84170 XP_003751760.1.100692 XP_003788834.1.62490 XP_003788845.1.62490 XP_003804483.1.60992 XP_003804599.1.60992 XP_003927315.1.74449 XP_003927325.1.74449 XP_003985754.1.62641 XP_003985775.1.62641 XP_004019133.1.66739 XP_004043427.1.27298 XP_004043452.1.27298 XP_004273534.1.21590 XP_004273545.1.21590 XP_004384075.1.4749 XP_004406572.1.74151 XP_004413715.1.74151 XP_004621950.1.94378 XP_004694925.1.23501 XP_005337114.1.77405 XP_005354997.1.66349 XP_005553871.1.63531 XP_005553918.1.63531 XP_005696800.1.57651 XP_005892264.1.15283 XP_005982808.1.78601 XP_005982820.1.78601 XP_006048074.1.26621 XP_006048086.1.26621 XP_006735956.1.47382 XP_006735970.1.47382 XP_006872871.1.41390 XP_006872876.1.41390 XP_006872878.1.41390 XP_006888683.1.29581 XP_006888687.1.29581 XP_006888697.1.29581 XP_006988913.1.50099 XP_006988921.1.50099 XP_006988922.1.50099 XP_006988928.1.50099 XP_006993208.1.50099 XP_006993217.1.50099 XP_006993222.1.50099 XP_006993227.1.50099 XP_006999013.1.50099 XP_007128665.1.24612 XP_007128669.1.24612 XP_007177445.1.59432 XP_007471298.1.90284 XP_007534632.1.11023 XP_007534638.1.11023 XP_007534640.1.11023 XP_007634640.1.28591 XP_007634649.1.28591 XP_007634652.1.28591 XP_007634672.1.28591 XP_007640989.1.69978 XP_007948034.1.48129 XP_007948043.1.48129 XP_007971663.1.81039 XP_008055794.1.4292 XP_008539408.1.77740 XP_008772192.1.4139 XP_008772223.1.4139 XP_008824848.1.79516 XP_008824854.1.79516 XP_008824864.1.79516 XP_008830082.1.79516 XP_008830085.1.79516 XP_008830089.1.79516 XP_008830106.1.79516 XP_008830108.1.79516 XP_009239780.1.23681 XP_010362926.1.97406 XP_010363165.1.97406 XP_010816817.1.76553 XP_010823718.1.59421 XP_010841743.1.44457 XP_010972510.1.22495 XP_010972512.1.22495 XP_010978462.1.51371 XP_011741069.1.29376 XP_011741093.1.29376 XP_011818218.1.43180 XP_011818254.1.43180 XP_011821825.1.47321 XP_011821859.1.47321 XP_011886926.1.92194 XP_011886950.1.92194 XP_011956521.1.66739 XP_012020668.1.54773 XP_012020687.1.54773 XP_012314002.1.9421 XP_012314003.1.9421 XP_012494063.1.63892 XP_012494066.1.63892 XP_012596784.1.48125 XP_012890658.1.60039 XP_012890659.1.60039 XP_013219112.1.77405 XP_013219115.1.77405 XP_013829531.1.57651 XP_013966078.1.84170 XP_014332611.1.15283 XP_014412656.1.101512 XP_014589726.1.31192 XP_014707047.1.49734 XP_015107244.1.17985 XP_015349606.1.40921 XP_015349608.1.40921 XP_015349610.1.40921 XP_016830963.1.69978 XP_017200430.1.1745 XP_017360675.1.71028 XP_017360676.1.71028 XP_017360677.1.71028 XP_017704642.1.44346 XP_017704644.1.44346 XP_017826321.1.60252 XP_019280717.1.44245 XP_019280719.1.44245 XP_019800701.1.83887 XP_019800702.1.83887 XP_019841102.1.53367 XP_020008972.1.5219 XP_020742300.1.74333 XP_020954090.1.46622 XP_020954092.1.46622 XP_021071328.1.100879 XP_021071382.1.100879 XP_021071383.1.100879 XP_021071621.1.100879 XP_527262.2.37143 XP_577577.1.100692 trt001000236.1 trt001000237.1 ENSBTAP00000042429 ENSRNOP00000041952 ENSRNOP00000044846 ENSRNOP00000056101 ENSMMUP00000029040 ENSMMUP00000031251 ENSPANP00000008103 ENSPANP00000015127 ENSSSCP00000021473 ENSSSCP00000024551 ENSOPRP00000003173 ENSOCUP00000018241 ENSOCUP00000024204 ENSCAFP00000035973 ENSLAFP00000005498 ENSSTOP00000017567 ENSSTOP00000020318 ENSBTAP00000042429 ENSEEUP00000008167 ENSVPAP00000007647 ENSECAP00000005243 ENSTTRP00000015888 ENSVPAP00000007647 ENSP00000259791 ENSP00000303373 ENSTSYP00000012375 2cv5_C 2cv5_G 5xf3_C 5xf3_G 5xf4_C 5xf4_G 5xf5_C 5xf5_G 6buz_C 6buz_G 6etx_K 6etx_O ENSSARP00000003820 ENSSARP00000004351 ENSMUSP00000077477 ENSMUSP00000080088 ENSMUSP00000088281 ENSMUSP00000088285 ENSMUSP00000089335 ENSMUSP00000089339 ENSMUSP00000089345 ENSMUSP00000100034 ENSMUSP00000127684 ENSPTRP00000030389 ENSPTRP00000030406 ENSSSCP00000021473 ENSSSCP00000024551 ENSDORP00000004906 ENSDORP00000004922 ENSLAFP00000005498 10090.ENSMUSP00000077477 10090.ENSMUSP00000080088 10090.ENSMUSP00000088281 10090.ENSMUSP00000088285 10090.ENSMUSP00000089300 10090.ENSMUSP00000089335 10090.ENSMUSP00000089339 10090.ENSMUSP00000089345 10090.ENSMUSP00000100034 10116.ENSRNOP00000041952 10116.ENSRNOP00000044846 10116.ENSRNOP00000056101 9544.ENSMMUP00000029040 9544.ENSMMUP00000031251 9598.ENSPTRP00000030389 9598.ENSPTRP00000030406 9606.ENSP00000259791 9606.ENSP00000303373 9685.ENSFCAP00000007654 9796.ENSECAP00000005243 9823.ENSSSCP00000001185 9823.ENSSSCP00000001204 9913.ENSBTAP00000042429 9986.ENSOCUP00000018241 9986.ENSOCUP00000024204 ENSNLEP00000022246 ENSNLEP00000022259 ENSTSYP00000012375 ENSOPRP00000003173 2cv5C ENSGGOP00000012906 ENSGGOP00000016173 ENSOGAP00000007169 ENSOGAP00000020010 ENSMUSP00000077477 ENSMUSP00000080088 ENSMUSP00000088281 ENSMUSP00000088285 ENSMUSP00000089335 ENSMUSP00000089339 ENSMUSP00000089345 ENSMUSP00000100034 ENSMUSP00000127684 ENSMMUP00000029040 ENSMMUP00000031251 ENSRNOP00000042744 ENSRNOP00000065692 ENSRNOP00000066670 ENSEEUP00000008167 ENSNLEP00000022246 ENSNLEP00000022259 ENSOCUP00000018241 ENSOCUP00000024204 ENSFCAP00000019804 ENSFCAP00000022402 ENSSARP00000003820 ENSSARP00000004351 ENSPCAP00000004930 ENSPCAP00000004930 ENSECAP00000005243 ENSTTRP00000015888 ENSPTRP00000030389 ENSPTRP00000030406 ENSGGOP00000012906 ENSGGOP00000016173 ENSP00000303373 ENSP00000483842 ENSOGAP00000007169 ENSOGAP00000020010 ENSMUSP00000077477 ENSMUSP00000080088 ENSMUSP00000088281 ENSMUSP00000088285 ENSMUSP00000089335 ENSMUSP00000089339 ENSMUSP00000089345 ENSMUSP00000100034 ENSMUSP00000127684 ENSDORP00000004906 ENSDORP00000004922 cath|current|2cv5C00/11-118 cath|current|2cv5G00/15-118 ENSSTOP00000017567 ENSSTOP00000020318 ENSP00000259791 ENSP00000303373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]