SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030390 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030390
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 9.16e-60
Family Nucleosome core histones 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030390   Gene: ENSPTRG00000017802   Transcript: ENSPTRT00000032890
Sequence length 126
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26309559:26309939:-1 gene:ENSPTRG00000017802 transcript:ENSPTRT00000032890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences A0A096N303 A0A0D9SCL8 A0A1S3AGI5 A0A1S3GQX9 A0A1U7V0H0 A0A287D2B9 A0A2I3HHT9 A0A2K5BXK3 A0A2K5HGU5 A0A2K5KRQ6 A0A2K5PG71 A0A2K5XM60 A0A2K6ASY1 A0A2K6KN45 A0A2K6N764 F2Z580 F7AHT9 G1SSZ8 G3QXG0 G3UAY2 G5BQE1 G7MR19 G7P2L5 H2QSF6 J9NWG3 L7N1J3 L8YEH0 P33778 S7PCY9
ENSNLEP00000022247 gi|10800140|ref|NP_066406.1| ENSP00000350580 ENSGGOP00000007503 NP_066406.1.87134 NP_066406.1.92137 XP_001084180.1.72884 XP_001172713.1.37143 XP_001496893.1.31192 XP_002746195.1.60252 XP_003263293.1.23891 XP_003416471.1.64505 XP_003804600.1.60992 XP_003985774.1.62641 XP_004019135.1.66739 XP_004043432.1.27298 XP_004384084.1.4749 XP_004463556.1.11602 XP_004621951.1.94378 XP_004847624.1.39548 XP_005337103.1.77405 XP_005337121.1.77405 XP_005553919.1.63531 XP_005696813.1.57651 XP_005863143.1.60319 XP_005982821.1.78601 XP_006048087.1.26621 XP_006105754.1.53796 XP_006162709.1.99106 XP_006735955.1.47382 XP_006872877.1.41390 XP_007074501.1.5354 XP_007534639.1.11023 XP_007948032.1.48129 XP_008071696.1.4292 XP_008260681.1.1745 XP_008526332.1.77740 XP_008539709.1.77740 XP_008539713.1.77740 XP_008585850.1.73410 XP_008830107.1.79516 XP_010363173.1.97406 XP_010621297.1.5607 XP_011741068.1.29376 XP_011818217.1.43180 XP_011821860.1.47321 XP_011886925.1.92194 XP_012020667.1.54773 XP_012314006.1.9421 XP_012419977.1.74151 XP_012890669.1.60039 XP_014644182.1.5094 XP_014707055.1.49734 XP_014941941.1.86478 XP_017360683.1.71028 XP_017704649.1.44346 XP_019280745.1.44245 XP_020009055.1.5219 XP_020742304.1.74333 XP_020954093.1.46622 XP_853817.1.84170 ENSSTOP00000020026 ENSSTOP00000023122 ENSPTRP00000030390 ENSPANP00000006701 ENSPTRP00000030390 ENSOCUP00000006407 ENSMLUP00000009230 ENSSARP00000004354 ENSNLEP00000022247 ENSLAFP00000024990 ENSMLUP00000009230 ENSCAFP00000037508 ENSTSYP00000013243 ENSDORP00000004908 ENSDNOP00000000456 ENSDNOP00000024800 ENSECAP00000002983 ENSLAFP00000024990 ENSTSYP00000013243 ENSP00000350580 ENSSARP00000004354 ENSFCAP00000018026 9361.ENSDNOP00000000456 9598.ENSPTRP00000030390 9606.ENSP00000350580 9796.ENSECAP00000002983 9823.ENSSSCP00000001186 9986.ENSOCUP00000006407 ENSDORP00000004908 ENSOCUP00000006407 ENSECAP00000002983 ENSPCAP00000013276 ENSGGOP00000007503 ENSCAFP00000037508 ENSP00000482674 ENSEEUP00000002514 ENSPCAP00000013276 HGL_H00000350580 ENSSTOP00000020026 ENSSTOP00000023122 ENSEEUP00000002514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]