SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030396 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030396
Domain Number 1 Region: 14-115
Classification Level Classification E-value
Superfamily Histone-fold 2.96e-76
Family Nucleosome core histones 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030396   Gene: ENSPTRG00000017809   Transcript: ENSPTRT00000032905
Sequence length 130
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26388572:26403543:1 gene:ENSPTRG00000017809 transcript:ENSPTRT00000032905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
Download sequence
Identical sequences A0A024R017 A0A0D9SCL4 A0A1S3AG70 A0A1S3GPQ7 A0A250Y9M5 A0A2F0B5V8 A0A2I2Y3I3 A0A2I3HHR4 A0A2I3MII7 A0A2K5BWW6 A0A2K5HAZ0 A0A2K5KPG0 A0A2K5XVI8 A0A2K6AXP1 A0A2K6ENH7 A0A2K6JRW2 A0A2K6NT40 A0A2K6S8J8 D2I4V1 F2Z4J1 F7BVY4 F7HAP4 F7INS8 G1SVP6 G7P2M2 H0XYJ6 H2PI56 H2QSG1 I3MGW7 J9P664 M3WYW4 P0C169 Q93077
ENSOCUP00000007513 ENSEEUP00000014450 ENSOPRP00000007705 9544.ENSMMUP00000031276 9598.ENSPTRP00000030396 9600.ENSPPYP00000018238 9606.ENSP00000321389 9685.ENSFCAP00000005548 9796.ENSECAP00000005025 9823.ENSSSCP00000001214 9913.ENSBTAP00000048056 9986.ENSOCUP00000007513 ENSVPAP00000007654 ENSNLEP00000003810 ENSGGOP00000017949 ENSCJAP00000040226 ENSP00000321389 ENSP00000367022 ENSP00000473534 ENSCHOP00000012419 ENSCAFP00000041146 ENSCJAP00000040226 ENSTSYP00000006281 ENSPCAP00000010527 ENSOPRP00000007705 ENSTSYP00000006281 ENSPANP00000003845 ENSPTRP00000030396 ENSOGAP00000021189 ENSBTAP00000048056 ENSOGAP00000021189 ENSFCAP00000019554 ENSFCAP00000005548 ENSTTRP00000015877 ENSBTAP00000048056 ENSECAP00000005025 ENSVPAP00000007654 ENSNLEP00000003810 ENSP00000321389 ENSP00000367022 ENSP00000473534 ENSCAFP00000041146 ENSEEUP00000014450 ENSDORP00000004915 ENSPPYP00000018238 ENSPPYP00000018238 ENSDORP00000004915 ENSCHOP00000012419 gi|4504245|ref|NP_003503.1| ENSTTRP00000015877 ENSECAP00000005025 ENSOCUP00000007513 ENSPCAP00000010527 ENSPTRP00000030396 NP_001180707.1.72884 NP_001192525.1.59421 NP_001192525.1.76553 NP_003503.1.87134 NP_003503.1.92137 XP_002816562.1.23681 XP_003311095.1.37143 XP_003311096.1.37143 XP_003788833.1.62490 XP_003804592.1.60992 XP_003927318.1.74449 XP_003985768.1.62641 XP_004019127.1.66739 XP_004043437.1.27298 XP_004043438.1.27298 XP_004088805.1.23891 XP_004088806.1.23891 XP_004273548.1.21590 XP_004316326.1.83887 XP_004384081.1.4749 XP_004406577.1.74151 XP_004463560.1.11602 XP_004694919.1.23501 XP_005553880.1.63531 XP_005603678.1.31192 XP_005640150.1.84170 XP_005696809.1.57651 XP_005982816.1.78601 XP_005982817.1.78601 XP_005982818.1.78601 XP_005982819.1.78601 XP_006048081.1.26621 XP_006218990.1.17985 XP_006735971.1.47382 XP_006736832.1.47382 XP_006736838.1.47382 XP_006872863.1.41390 XP_006888692.1.29581 XP_007177435.1.59432 XP_007471290.1.90284 XP_007534635.1.11023 XP_007948027.1.48129 XP_007971674.1.81039 XP_008585834.1.73410 XP_008585835.1.73410 XP_008585836.1.73410 XP_008585837.1.73410 XP_008691184.1.72690 XP_008691186.1.72690 XP_008992070.1.60252 XP_009239771.1.23681 XP_010336293.1.74449 XP_010363093.1.97406 XP_010841736.1.44457 XP_010841737.1.44457 XP_011215280.1.58354 XP_011741085.1.29376 XP_011818240.1.43180 XP_011821836.1.47321 XP_011886939.1.92194 XP_012020677.1.54773 XP_012494062.1.63892 XP_012596782.1.48125 XP_012596783.1.48125 XP_012890660.1.60039 XP_013219114.1.77405 XP_014644177.1.5094 XP_014707044.1.49734 XP_015315432.1.76553 XP_015349607.1.40921 XP_017200432.1.1745 XP_017360674.1.71028 XP_017520895.1.32401 XP_017520896.1.32401 XP_017704639.1.44346 XP_017704640.1.44346 XP_017826320.1.60252 XP_017894003.1.57651 XP_019280720.1.44245 XP_019841099.1.53367 XP_019841100.1.53367 XP_019841101.1.53367 XP_020742268.1.74333 XP_020954091.1.46622 XP_021523297.1.9421 XP_021552522.1.83697 ENSMMUP00000031276 ENSGGOP00000017949 ENSP00000321389 ENSMMUP00000031276 6c0w_C 6c0w_G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]