SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030398 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030398
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 1.23e-59
Family Nucleosome core histones 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030398   Gene: ENSPTRG00000017811   Transcript: ENSPTRT00000032907
Sequence length 126
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26422518:26435745:1 gene:ENSPTRG00000017811 transcript:ENSPTRT00000032907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences A0A024QZZ7 A0A096NAC1 A0A0D9R6C1 A0A1D5R0R7 A0A1U7THA5 A0A2I2YZY0 A0A2I3H8R1 A0A2I3S561 A0A2K5C6W9 A0A2K5HBW9 A0A2K5KMA9 A0A2K5XTB7 A0A2K6B1R7 A0A2K6KH29 A0A2K6NPE8 B2RTK3 F2Z584 F7E1X9 F7I3F9 G3U0S2 G7P2M4 H0WXH8 H2PI58 I3MUG9 L5JTM7 L8IS67 M3WSC7 P10854 P58876 Q2KII5 S9X6I9
ENSTTRP00000015880 ENSLAFP00000021430 ENSMICP00000005480 ENSFCAP00000017263 ENSFCAP00000020231 ENSPTRP00000030398 ENSMUSP00000106102 ENSGGOP00000027129 ENSCJAP00000020339 ENSCJAP00000046963 ENSNLEP00000003815 ENSPPYP00000018240 ENSPCAP00000013065 ENSP00000289316 ENSPCAP00000013065 ENSSSCP00000019541 ENSSSCP00000022927 ENSECAP00000005374 9544.ENSMMUP00000031280 9598.ENSPTRP00000030398 9600.ENSPPYP00000018240 9606.ENSP00000289316 9685.ENSFCAP00000003510 9685.ENSFCAP00000014075 9796.ENSECAP00000005374 9823.ENSSSCP00000001207 9823.ENSSSCP00000001208 9913.ENSBTAP00000027308 ENSCHOP00000000461 ENSECAP00000005374 ENSMICP00000005480 ENSLAFP00000021430 ENSOGAP00000007161 ENSPVAP00000016607 ENSSARP00000001846 ENSVPAP00000007656 ENSPTRP00000030398 ENSNLEP00000003815 NP_001039711.1.59421 NP_001039711.1.76553 NP_001230585.1.46622 NP_066407.1.87134 NP_066407.1.92137 NP_619790.1.87134 NP_619790.1.92137 NP_835507.1.92730 XP_003263311.1.23891 XP_003363815.1.31192 XP_003416463.1.64505 XP_003788837.1.62490 XP_003985763.1.62641 XP_003985766.1.62641 XP_004019125.1.66739 XP_004088807.1.23891 XP_004088808.1.23891 XP_004088809.1.23891 XP_004273541.1.21590 XP_004316324.2.83887 XP_004384078.1.4749 XP_004406579.1.74151 XP_004621948.1.94378 XP_005223819.1.76553 XP_005696807.1.57651 XP_005696808.1.57651 XP_005892272.1.15283 XP_006048066.1.26621 XP_006048067.1.26621 XP_006048068.1.26621 XP_006182234.1.101512 XP_006735962.1.47382 XP_006735966.1.47382 XP_006923538.1.64745 XP_006931455.1.62641 XP_006988931.1.50099 XP_007074506.1.5354 XP_007096070.1.5354 XP_007096071.1.5354 XP_007128682.1.24612 XP_007128683.1.24612 XP_007471288.1.90284 XP_007948025.1.48129 XP_008055788.1.4292 XP_008539392.1.77740 XP_008539393.1.77740 XP_008585839.1.73410 XP_008585840.1.73410 XP_008691187.1.72690 XP_010841734.1.44457 XP_010972500.1.22495 XP_011280384.1.62641 XP_012020679.1.54773 XP_012364224.1.23891 XP_012494069.1.63892 XP_012596785.1.48125 XP_014332613.1.15283 XP_014412658.1.101512 XP_014589728.1.31192 XP_014707049.1.49734 XP_014707050.1.49734 XP_014941931.1.86478 XP_014941932.1.86478 XP_014941935.1.86478 XP_014941936.1.86478 XP_015107247.1.17985 XP_015349612.1.40921 XP_015989134.1.101085 XP_016071766.1.3490 XP_017520907.1.32401 XP_019280729.1.44245 XP_019280730.1.44245 XP_019280731.1.44245 XP_019569752.1.88060 XP_019687256.1.62641 XP_019687257.1.62641 XP_019841105.1.53367 XP_020009004.1.5219 XP_020009007.1.5219 XP_020742265.1.74333 XP_021071627.1.100879 XP_021590094.1.77405 ENSCJAP00000020339 ENSOGAP00000007161 ENSMUSP00000106102 ENSP00000289316 ENSP00000367008 ENSMUSP00000106102 ENSFCAP00000003510 ENSFCAP00000014075 ENSPVAP00000016607 ENSPANP00000009625 ENSTTRP00000015880 ENSGGOP00000027129 ENSBTAP00000027308 ENSVPAP00000007656 ENSCHOP00000000461 ENSBTAP00000027308 ENSSARP00000001846 ENSPPYP00000018240 gi|10800138|ref|NP_066407.1| gi|20336752|ref|NP_619790.1| ENSP00000289316 ENSP00000367008 ENSMMUP00000031280 ENSSSCP00000019541 ENSSSCP00000022927 ENSMMUP00000031280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]