SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030400 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030400
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Histone-fold 6.29e-33
Family Nucleosome core histones 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030400   Gene: ENSPTRG00000017813   Transcript: ENSPTRT00000032909
Sequence length 104
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26453158:26453472:-1 gene:ENSPTRG00000017813 transcript:ENSPTRT00000032909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVL
KVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Download sequence
Identical sequences A0A0K8RQR8
ENSPTRP00000030400 ENSPTRP00000030400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]