SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030402 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030402
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily Histone-fold 2.99e-48
Family Nucleosome core histones 0.00000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030402   Gene: ENSPTRG00000029801   Transcript: ENSPTRT00000032911
Sequence length 130
Comment pep:novel chromosome:CHIMP2.1.4:6:28107331:28107723:-1 gene:ENSPTRG00000029801 transcript:ENSPTRT00000032911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARTKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
Download sequence
Identical sequences A0A2J8NWP0
ENSPTRP00000030402 XP_003311177.1.37143 ENSPTRP00000030402 9598.ENSPTRP00000030402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]