SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030408 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030408
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Histone-fold 3.49e-32
Family Nucleosome core histones 0.00000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030408   Gene: ENSPTRG00000017820   Transcript: ENSPTRT00000032917
Sequence length 99
Comment pep:novel chromosome:CHIMP2.1.4:6:28143051:28143347:-1 gene:ENSPTRG00000017820 transcript:ENSPTRT00000032917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY
Download sequence
Identical sequences A0A2D0QJ38 L8ILE3 Q4TDZ1
ENSSARP00000001909 ENSSARP00000008074 ENSSARP00000001909 ENSSARP00000008074 ENSPTRP00000030408 ENSPTRP00000030408 ENSTTRP00000015893 ENSTTRP00000015893 ENSOPRP00000011457 XP_017318433.1.5077 XP_017545842.1.86671 XP_021486308.1.76796 ENSOPRP00000011457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]