SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030409 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030409
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Histone-fold 1.04e-21
Family Nucleosome core histones 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030409   Gene: ENSPTRG00000017821   Transcript: ENSPTRT00000032918
Sequence length 98
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:26512994:26513290:-1 gene:ENSPTRG00000017821 transcript:ENSPTRT00000032918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRGKGGKGLGKGGATCHRKVLSDNIQGITKCTIRRLAQHGGVKRISGLIYEETPRVFK
VFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL
Download sequence
Identical sequences A0A2J8JQG4
9598.ENSPTRP00000030409 ENSPTRP00000030409 ENSPTRP00000030409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]