SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030444 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030444
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 2.55e-48
Family Nucleosome core histones 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030444   Gene: ENSPTRG00000030411   Transcript: ENSPTRT00000032959
Sequence length 129
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:128036222:128036652:1 gene:ENSPTRG00000030411 transcript:ENSPTRT00000032959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHKAKSK
Download sequence
Identical sequences A0A096NBR7 A0A0D9SA89 A0A1S3A9Z0 A0A1S3F203 A0A1U7T3Z0 A0A2I3TSY0 A0A2K5BUG7 A0A2K5JM62 A0A2K5KWR9 A0A2K5PBL5 A0A2K5YKH9 A0A2K6B6Q9 A0A2K6K339 A0A2K6NPJ6 A0A2K6SEP2 A1A4R1 D2I4V2 F1PFZ7 F2Z5L5 F7BRD9 G1S9J5 G3QKC7 G7NTR6 H0WTT6 H2N612 I3NFZ3 K7F0R6 L5K5G0 L5MER2 M3X8W3 M3Z3Z3 M7BIJ1 Q149V4 Q16777 Q64523 S9WM44 U3DRY5 W5PUU8
NP_001075189.1.59421 NP_001075189.1.76553 NP_003508.1.87134 NP_003508.1.92137 NP_783593.1.92730 XP_001061850.3.4139 XP_001096626.1.72884 XP_002930269.1.58354 XP_003259202.1.23891 XP_003639664.1.84170 XP_003942032.1.74449 XP_003990605.1.62641 XP_004002481.1.66739 XP_004026602.1.27298 XP_004285173.1.21590 XP_004315559.1.83887 XP_004404234.1.74151 XP_004435994.1.5094 XP_004588892.1.84141 XP_004618108.1.94378 XP_004632468.1.9945 XP_004716624.1.18182 XP_004776889.1.14098 XP_005309001.1.60341 XP_005313475.1.60341 XP_005331198.1.77405 XP_005542099.1.63531 XP_005677761.1.57651 XP_006049266.1.26621 XP_006095233.1.53796 XP_006125971.1.96668 XP_006168561.1.99106 XP_006186637.1.101512 XP_006216977.1.17985 XP_006750231.1.47382 XP_006861411.1.41390 XP_006902294.1.29581 XP_006982636.1.50099 XP_007064108.1.26238 XP_007114487.1.24612 XP_007463540.1.90284 XP_007531634.1.11023 XP_007949163.1.48129 XP_008017401.1.81039 XP_008052490.1.4292 XP_008154020.1.99482 XP_008583793.1.73410 XP_008968753.1.60992 XP_009243233.1.23681 XP_010385600.1.97406 XP_010837039.1.44457 XP_010956824.1.22495 XP_010994990.1.51371 XP_011767452.1.29376 XP_011793139.1.43180 XP_011829042.1.47321 XP_011924833.1.92194 XP_012016758.1.54773 XP_012317962.1.9421 XP_012609568.1.48125 XP_012667242.1.62490 XP_012870633.1.60039 XP_012903432.1.14098 XP_012903433.1.14098 XP_013852658.1.46622 XP_014396220.1.60319 XP_014439644.1.99106 XP_014720922.1.49734 XP_015414182.1.95426 XP_015856618.1.50099 XP_015856619.1.50099 XP_015978330.1.101085 XP_016070981.1.3490 XP_017401900.1.71028 XP_017733347.1.44346 XP_019288440.1.44245 XP_019288442.1.44245 XP_019288443.1.44245 XP_019480903.1.44202 XP_019595437.1.88060 XP_020008991.1.5219 XP_020755541.1.74333 XP_021051035.1.100879 XP_513764.2.37143 XP_574997.4.100692 ENSP00000228929 ENSP00000332194 ENSPSIP00000001626 ENSPVAP00000013350 ENSSSCP00000007112 ENSSTOP00000018206 ENSRNOP00000040177 ENSCHOP00000000507 ENSGGOP00000002901 ENSEEUP00000004336 ENSMUSP00000088288 ENSOPRP00000009844 ENSNLEP00000022186 ENSEEUP00000004336 ENSOARP00000014230 ENSPANP00000010222 ENSGGOP00000002901 ENSNLEP00000022186 ENSMMUP00000001937 ENSMPUP00000018305 ENSSTOP00000018206 ENSPSIP00000001626 ENSMUSP00000088288 ENSTTRP00000004837 ENSMMUP00000001937 ENSTTRP00000004837 ENSMICP00000000260 ENSPPYP00000001070 ENSOGAP00000005588 ENSCAFP00000017000 ENSCHOP00000000507 gi|24638446|ref|NP_003508.1| ENSRNOP00000040177 ENSMPUP00000018305 ENSP00000228929 ENSP00000332194 ENSSSCP00000007112 10090.ENSMUSP00000088288 10116.ENSRNOP00000040177 9544.ENSMMUP00000001937 9598.ENSPTRP00000030444 9600.ENSPPYP00000001070 9606.ENSP00000332194 9823.ENSSSCP00000007112 ENSPTRP00000030444 ENSP00000332194 ENSOPRP00000009844 ENSFCAP00000023065 ENSPVAP00000013350 ENSOGAP00000005588 ENSPTRP00000030444 ENSCAFP00000017000 ENSMICP00000000260 ENSMUSP00000088288 ENSPPYP00000001070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]