SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030446 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030446
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-48
Family Nucleosome core histones 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030446   Gene: ENSPTRG00000017852   Transcript: ENSPTRT00000032961
Sequence length 128
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:28085984:28086370:-1 gene:ENSPTRG00000017852 transcript:ENSPTRT00000032961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKTK
Download sequence
Identical sequences A0A096NBW8 A0A0D9SCK3 A0A1U7ULF5 A0A2K5HFR7 A0A2K5UJK7 A0A2K5XJ63 A0A2K6ASZ3 A0A2K6NP58 F7C6Q8 G1SAV4 G3RM71 H0XEX0 H2PI86 H2QSI6 Q99878 S9Y6R5
ENSDNOP00000006267 ENSDNOP00000013272 ENSDNOP00000015642 ENSTTRP00000014923 ENSP00000328484 gi|10800144|ref|NP_066544.1| ENSDNOP00000033309 ENSPTRP00000030446 9361.ENSDNOP00000006267 9361.ENSDNOP00000013272 9361.ENSDNOP00000015642 9544.ENSMMUP00000034287 9598.ENSPTRP00000030446 9600.ENSPPYP00000018277 9606.ENSP00000328484 ENSP00000328484 ENSNLEP00000022653 ENSPPYP00000018277 ENSGGOP00000016885 ENSOGAP00000014524 ENSPPYP00000018277 ENSMMUP00000034287 ENSTSYP00000001038 ENSGGOP00000016885 ENSTSYP00000001038 NP_001180966.1.72884 NP_066544.1.87134 NP_066544.1.92137 XP_001138786.1.37143 XP_003272004.1.23891 XP_003801910.1.62490 XP_003829743.1.60992 XP_004043513.1.27298 XP_004273510.1.21590 XP_004477774.1.11602 XP_004481911.1.11602 XP_005553797.1.63531 XP_006218977.1.17985 XP_006872845.1.41390 XP_006872847.1.41390 XP_007128634.1.24612 XP_007128635.1.24612 XP_007471319.1.90284 XP_007955082.1.48129 XP_007971589.1.81039 XP_008071005.1.4292 XP_010372588.1.97406 XP_010816748.1.76553 XP_010823687.1.59421 XP_011756530.1.29376 XP_011800325.1.43180 XP_011846638.1.47321 XP_011931492.1.92194 XP_015349640.1.40921 XP_019800467.1.83887 ENSNLEP00000022653 ENSOGAP00000014524 ENSTTRP00000014923 ENSPTRP00000030446 ENSMMUP00000034287 ENSP00000328484 ENSPANP00000010274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]