SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030746 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030746
Domain Number 1 Region: 208-339
Classification Level Classification E-value
Superfamily TPR-like 6.27e-28
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000115
Family FKBP immunophilin/proline isomerase 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030746   Gene: ENSPTRG00000018006   Transcript: ENSPTRT00000033280
Sequence length 349
Comment pep:known chromosome:CHIMP2.1.4:6:32395950:32397579:-1 gene:ENSPTRG00000018006 transcript:ENSPTRT00000033280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQIL
EHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIIIRGHGLDKPKL
GSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGH
SGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALG
NLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG
Download sequence
Identical sequences H2QSQ6
ENSPTRP00000030746 ENSPTRP00000030746 XP_001162639.1.37143 XP_003829826.1.60992 XP_009449229.1.37143 XP_016810709.1.37143 XP_016810710.1.37143 9598.ENSPTRP00000030746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]