SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030871 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030871
Domain Number 1 Region: 113-201
Classification Level Classification E-value
Superfamily Histone-fold 3.19e-37
Family TBP-associated factors, TAFs 0.0000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030871   Gene: ENSPTRG00000018075   Transcript: ENSPTRT00000033411
Sequence length 211
Comment pep:known chromosome:CHIMP2.1.4:6:35316217:35328690:-1 gene:ENSPTRG00000018075 transcript:ENSPTRT00000033411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADADLKEAAAEEGELKS
QDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNR
YEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMP
PLQPKHMREAVRRLKSKGQIPNSKHKKIIFF
Download sequence
Identical sequences H2QSV3
9598.ENSPTRP00000030871 ENSPTRP00000030871 ENSPTRP00000030871 XP_003808582.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]