SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031037 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031037
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Histone-fold 0.0000193
Family Archaeal histone 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031037   Gene: ENSPTRG00000018165   Transcript: ENSPTRT00000033587
Sequence length 338
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:42624777:42655185:1 gene:ENSPTRG00000018165 transcript:ENSPTRT00000033587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVET
LTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT
APPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAA
SQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEET
DSSEQDEQTDTENLALHISMMESRSVTQAGVQWQDLGSLQPPPPGFKRFSSLSLLSSWNY
RRILEPRRRTPLSCSRTPPCRVAGMGRRTSSITLICGR
Download sequence
Identical sequences A0A2I3TG57
ENSPTRP00000031037 ENSPTRP00000031037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]