SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031150 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031150
Domain Number 1 Region: 46-79
Classification Level Classification E-value
Superfamily Histone-fold 0.00000454
Family TBP-associated factors, TAFs 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031150
Domain Number - Region: 286-306
Classification Level Classification E-value
Superfamily Histone-fold 0.0372
Family TBP-associated factors, TAFs 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031150   Gene: ENSPTRG00000023379   Transcript: ENSPTRT00000033706
Sequence length 328
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:45497276:45975278:-1 gene:ENSPTRG00000023379 transcript:ENSPTRT00000033706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVFGTTFFNFDSFIGKTDTIEVIGKSVFPYCYHSILPLLNDSGRYSLGDARRPLHETAV
LVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSK
IVKGIDEDDLLEDKLSGSNNANKRQKIAQDFLNSIDQTGELLAVFEDDEIDEVKQERMER
AERQTRIMDSAQYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETV
AQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREA
IRRYSHRIGPLSPFTNAYRRNGMAFLAC
Download sequence
Identical sequences H2QT40
ENSPTRP00000031150 ENSPTRP00000031150 XP_016811122.1.37143 9598.ENSPTRP00000031150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]