SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031205 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031205
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 8.48e-166
Family Phosphoglycerate kinase 0.00000000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031205   Gene: ENSPTRG00000018264   Transcript: ENSPTRT00000033765
Sequence length 417
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:50477315:50478565:-1 gene:ENSPTRG00000018264 transcript:ENSPTRT00000033765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVL
MSHLGRPDGVPMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVH
LPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGK
ATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
KATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNI
Download sequence
Identical sequences A0A2J8P0U4
ENSPTRP00000031205 9598.ENSPTRP00000031205 ENSPTRP00000031205 XP_003833221.1.60992 XP_518531.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]