SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031505 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031505
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.5e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 5-53
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031505   Gene: ENSPTRG00000018447   Transcript: ENSPTRT00000034090
Sequence length 766
Comment pep:known chromosome:CHIMP2.1.4:6:101304295:101378512:-1 gene:ENSPTRG00000018447 transcript:ENSPTRT00000034090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYTSSS
TPTMTDNRKGAKSRLSSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLL
DPADRPGSQHDASCAYRQFSDRSSLCYGFALDHSRLVEERHFHTQACEGGRCEAGRYFLG
TPQAGREPWWGSRAALPLTKASPESREAYENSMPHIASVHRIHGRGHWDEDSVVSSPDPG
SASESGDRYRTEQYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKAPSDQLASINGAGK
KHSLCFANYQQPPPTGEICHGSALANTSPCDHIQQREGKMLSPRENDYDNSPTALSRISS
PNSDRISKSSLILAKDYLHSDISPHQTAGDHPTVSPNCFGSHRQYLDKHAYTLTGYALEH
LYDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
Download sequence
Identical sequences A0A2J8PUY2 A2T6X9
ENSPTRP00000031505 NP_001074957.1.37143 XP_009449955.1.37143 ENSPTRP00000031505 9598.ENSPTRP00000031505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]