SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031795 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031795
Domain Number 1 Region: 8-486
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-161
Family ALDH-like 0.0000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031795   Gene: ENSPTRG00000018629   Transcript: ENSPTRT00000034397
Sequence length 487
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:136255466:136288961:-1 gene:ENSPTRG00000018629 transcript:ENSPTRT00000034397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPG
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
SLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRKWKVGIPSDPLVSMGALISEAHLEKVRSYVKRALAEGAQIWCGEGVDK
LSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITVKH
Download sequence
Identical sequences H2QTS3
ENSPTRP00000031795 XP_008951274.1.60992 XP_016811814.1.37143 ENSPTRP00000031795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]